1. Dissecting the Oncogenic Roles of Keratin 17 in the Hallmarks of Cancer
In addition, K17 regulates the expression of various transcription factors that have been found to underlie the pathogenesis of cutaneous basal cell carcinoma, ...
There is an unmet need to identify and validate tumor-specific therapeutic targets to enable more effective treatments for cancer. Heterogeneity in patient clinical characteristics as well as biological and genetic features of tumors present major ...
2. KCNK17 potassium two pore domain channel subfamily K member 17 ...
17 jun 2024 · The rs10947803 SNP of KCNK17 is associated with cerebral hemorrhage but not ischemic stroke in a Chinese population.
Gene ID: 89822, updated on 19-Sep-2024
3. Transcript of Media Doorstop on the Detention of a Self-Radicalised 17 ...
18 okt 2024 · Minister: ISD has detained a 17-year-old under the Internal Security Act. He was self-radicalised online, became a supporter of ISIS, and it ...
Transcript of Media Doorstop on the Detention of a Self-Radicalised 17-Year-Old Youth With Mr K Shanmugam, Minister for Home Affairs and Minister for Law
4. Molecular cloning of novel transcripts of human kallikrein-related ... - Nature
11 dec 2017 · In this study, we describe the discovery and molecular cloning of thirty novel transcripts of the human KLK5, KLK6, KLK7, KLK8 and KLK9 genes.
Alternative splicing of cancer-related genes is a common cellular mechanism accounting for cancer cell transcriptome complexity and affecting cell cycle control, proliferation, apoptosis, angiogenesis, invasion, and metastasis. In this study, we describe the discovery and molecular cloning of thirty novel transcripts of the human KLK5, KLK6, KLK7, KLK8 and KLK9 genes, using 3′ rapid amplification of cDNA ends (3′ RACE) and NGS technology, as well as their expression analysis in many established cell lines, originating from several distinct cancerous and normal tissues. Extensive bioinformatic analysis revealed novel splice variants of these five members of the KLK family, comprising entirely new exons, previously unknown boundaries of the already annotated exons (extensions and truncations) as well as alternative splicing events between these exons. Nested RT-PCR in a panel of human cell lines originating from seventeen cancerous and two normal tissues with the use of variant-specific pairs of primers was carried out for expression analysis of these novel splice variants, and Sanger sequencing of the respective amplicons confirmed our NGS results. Given that some splice variants of KLK family members possess clinical value, novel alternatively spliced transcripts appear as new candidate biomarkers for diagnostic and/or prognostic purposes and as targets for therapeutic strategies.
5. [PDF] Stranded Transcript Count Table Generation from Long Reads V.17
21 sep 2022 · sort -t ',' -k 1r,1 -k 14rn,14 | \ sort -t ',' -k 1r,1 -k 2,2 -k 3,3 -u | \ gzip > mapped/trnMapping_LAST_${bc}_vs_Mmus_transcriptome.csv.gz ...
6. B0280.17.1 (transcript) - WormBase : Nematode Information Resource
Coding transcript: An automatically generated transcript ... B0280.17. status: Partially confimed by cDNA(s) ... KELQIMTNIYESNDSVKFRNAHNLLVREIKRVYD ...
Questions, Feedback & Help
7. Mini Transcription Update 17 - Rusty Quill
24 jan 2022 · We are rather confident that we will release 76 Stellar Firma, 200 The Magnus Archives and 218 Rusty Quill Gaming transcripts in February.
Rusty Quill is an industry leading independent production company and podcast network.
8. Robust Coreference Resolution and Entity Linking on Dialogues
... transcripts. We first augment and correct several cases of annotation errors ... https://aclanthology.org/K17-1023; DOI: 10.18653/v1/K17-1023; Bibkey ...
Henry Y. Chen, Ethan Zhou, Jinho D. Choi. Proceedings of the 21st Conference on Computational Natural Language Learning (CoNLL 2017). 2017.
9. An R2R3 MYB transcription factor associated with regulation of the ...
21 mrt 2010 · ... [17]. Those associated with up-regulation of the anthocyanin pathway are ... Saitoh K, Onishi K, Mikami I, Thidar K, Sano Y: Allelic ...
The control of plant anthocyanin accumulation is via transcriptional regulation of the genes encoding the biosynthetic enzymes. A key activator appears to be an R2R3 MYB transcription factor. In apple fruit, skin anthocyanin levels are controlled by a gene called MYBA or MYB1, while the gene determining fruit flesh and foliage anthocyanin has been termed MYB10. In order to further understand tissue-specific anthocyanin regulation we have isolated orthologous MYB genes from all the commercially important rosaceous species. We use gene specific primers to show that the three MYB activators of apple anthocyanin (MYB10/MYB1/MYBA) are likely alleles of each other. MYB transcription factors, with high sequence identity to the apple gene were isolated from across the rosaceous family (e.g. apples, pears, plums, cherries, peaches, raspberries, rose, strawberry). Key identifying amino acid residues were found in both the DNA-binding and C-terminal domains of these MYBs. The expression of these MYB10 genes correlates with fruit and flower anthocyanin levels. Their function was tested in tobacco and strawberry. In tobacco, these MYBs were shown to induce the anthocyanin pathway when co-expressed with bHLHs, while over-expression of strawberry and apple genes in the crop of origin elevates anthocyanins. This family-wide study of rosaceous R2R3 MYBs provides insight into the evolution of this plant trait. It has implications for the development of new coloured fruit and flowers, as well a...
10. ER-Anchored Transcription Factors bZIP17 and bZIP28 Regulate Root ...
Our study reveals pivotal roles of bZIP17 in the plant UPR and vegetative development, with functional redundancy to bZIP28.
The bZIP17 and bZIP28 transcription factors have noncanonical target genes and redundantly contribute to both ER homeostasis and root elongation.
11. F11A5.17.1 (transcript) - WormBase : Nematode Information Resource
Coding transcript: An automatically generated transcript ... F11A5.17. status: Confirmed by cDNA(s). details. 594 ... KLDRWVFRELLQFTNITVQEKLVENLERQNWTLP ...
Questions, Feedback & Help
See AlsoMynord
12. The Magnus Protocol 17 – Saved Copy - The Magnus Archives - Acast
23 mei 2024 · ... K. BarnesDirected by Amani ZardoeExecutive Producers Alexander J ... Incident Elements:ScreamingHarsh Language Transcripts available at https:// ...
13. Letter from Linus Pauling to Warren K. Lewis. July 17, 1940. Transcript
Letter from Linus Pauling to Warren K. Lewis. July 17, 1940. Pauling writes to convey to Lewis the extent to which both he and other members of the Caltech ...
All Documents and Media
14. The Magnus Protocol Transcripts - Rusty Quill
Ep 17 - Saved Copy - The Magnus Protocol (v2)_Transcript.docx · Ep 18 - Solo ... Escape to close Control k to search ↑ ↓ to navigate ⏎ to select.
Rusty Quill is an industry leading independent production company and podcast network.
15. AM2014/243, Transcript of Proceedings [2017] FWCTrans 67 (17 ...
MR K WYDELL: Good morning, your Honour. Wydell, initial J. I appear for the Australian Maritime Officers Union. PN5. THE VICE PRESIDENT: Thank you. And the ...
Australasian Legal Information Institute (AustLII), a joint facility of UTS and UNSW Faculties of Law.
16. Transcript: Mayor de Blasio Announces 3-K for All - NYC.gov
24 apr 2017 · This is a story I hear all over the city from parents – what pre-K has meant for them, what it's meant to have their children getting that ...
Transcript: Mayor de Blasio Announces 3-K for All
17. NAC Transcription Factors NST1 and NST2 of Arabidopsis Regulate ...
Bevat niet: K | Resultaten tonen met:K
Abstract. In plants, secondary wall thickenings play important roles in various biological processes, although the factors regulating these processes remai
18. Transcript of interview of Castro by K. Jones and F. Mankiewicz ...
Archives · Transcript of interview of Castro by K. Jones and F. Mankiewicz: Spanish translation, 17-18 July 1974 · Transcript of interview of Castro by K. Jones ...
Download Folder KJPP-012-008
19. Mouse Gene H2-K1 (ENSMUST00000025181.17) from GENCODE ...
... K region (H2-K1), transcript variant 1, mRNA. (from RefSeq NM_001001892) Gencode Transcript: ENSMUST00000025181.17. Gencode Gene: ENSMUSG00000061232.16
Mouse Gene H2-K1 (ENSMUST00000025181.17) from GENCODE VM23 Comprehensive Transcript Set (only Basic displayed by default)
20. AFJAGS Reporter Podcast Episode 17 - JAG Reporter - AF.mil
AFJAGS Podcast: Episode 17. Transcript from AFJAGS Podcast: 15 June 2020 ... PAUL K. CARLTON JR., USAF (RET.) Two-part interview with retired Lieutenant ...
%PDF-1.7 %âãÏÓ 184 0 obj <> endobj xref 184 55 0000000016 00000 n 0000001984 00000 n 0000002180 00000 n 0000004624 00000 n 0000005047 00000 n 0000005486 00000 n 0000005993 00000 n 0000006438 00000 n 0000006924 00000 n 0000007298 00000 n 0000007335 00000 n 0000007761 00000 n 0000007875 00000 n 0000008272 00000 n 0000009131 00000 n 0000009931 00000 n 0000010313 00000 n 0000010441 00000 n 0000011110 00000 n 0000011748 00000 n 0000012339 00000 n 0000013197 00000 n 0000014028 00000 n 0000014828 00000 n 0000015555 00000 n 0000016344 00000 n 0000016673 00000 n 0000017086 00000 n 0000017754 00000 n 0000023688 00000 n 0000027032 00000 n 0000030255 00000 n 0000030594 00000 n 0000030824 00000 n 0000030970 00000 n 0000031116 00000 n 0000033765 00000 n 0000034158 00000 n 0000034549 00000 n 0000034778 00000 n 0000034902 00000 n 0000038343 00000 n 0000038761 00000 n 0000039262 00000 n 0000042737 00000 n 0000043139 00000 n 0000043642 00000 n 0000052988 00000 n 0000053238 00000 n 0000053631 00000 n 0000053706 00000 n 0000054031 00000 n 0000088411 00000 n 0000001807 00000 n 0000001396 00000 n trailer <<13390D3A26624F52BB454399D1FF411A>]/Prev 144019/XRefStm 1807>> startxref 0 %%EOF 238 0 obj <>stream hÞb```b``{ÉÀÆÀ "È È ¬@Q#ó¿5¼R(Ø Z!À=áYñçØK¿FCD@_lGôÄëóO,Î
21. 401(k) Real Talk Transcript for April 17, 2024 | Wealth Management
Transcript of Episode 102 of 401(k) Real Talk. Fred Barstein | Apr 17, 2024. Save. Greetings and welcome to this week's edition of 401k Real Talk.
Transcript of Episode 102 of 401(k) Real Talk.
22. Index of /speakup3e_accessible/asset/transcript
[TXT], citing_someone_else-s_idea.html, 2020-04-17 04:18, 1.4K.